westlakevillagefamilyservice.com - Westlake Village Thousand Oaks individual couple family group therapy

Description: Westlake Village Family Services Michael Kaufman, M.F.T., Psy.D. provides counseling and therapy services in and around ...

therapy (9831) mental health (4440) psychotherapy (4233) therapist (4063) psychotherapist (1670) psy.d. (42) m.f.t. (2) westlake village family services michael kaufman

Example domain paragraphs

You are using an outdated browser. Please upgrade your browser to improve your experience.

We process personal data about users of our site, through the use of cookies and other technologies, to deliver our services, personalize advertising, and to analyze site activity. We may share certain information about our users with our advertising and analytics partners. For additional details, refer to our Privacy Policy . By clicking \" I AGREE \" below, you agree to our Privacy Policy and our personal data processing and cookie practices as described therein. You also consent to the transfer of your d

Don't need the accessible version of this site?