newwestminsterfamilypractice.ca - New Westminster Family Practice

Example domain paragraphs

Opening January 2016!

242 - 610 Sixth St, New Westminster BC, V3L 3C2, (604) 521-8522

We are currently gathering feedback about how our clinic works. Please fill out this short survey to add your thoughts so we can continue to improve how we work

Links to newwestminsterfamilypractice.ca (1)